Proteintech, 21038-1-AP, FAM78A Polyclonal antibody

Size: 20ul / 150ul The FAM78A (21038-1-AP) by Proteintech is a Polyclonal antibody targeting FAM78A in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 21038-1-AP targets FAM78A in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse liver tissue, HepG2 cells, human liver tissue, mouse spleen tissue Positive IHC detected in: human tonsillitis tissue, human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15366 Product name: Recombinant human FAM78A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 5-57 aa of BC049388 Sequence: QSIGGKARVFREGITVIDVKASIDPVPTSIDESSSVVLRYRTPHFRASAQVVM Predict reactive species Full Name: family with sequence similarity 78, member A Calculated Molecular Weight: 283 aa, 32 kDa Observed Molecular Weight: 32-35 kDa GenBank Accession Number: BC049388 Gene Symbol: FAM78A Gene ID (NCBI): 286336 RRID: AB_10973677 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q5JUQ0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.