Iright
BRAND / VENDOR: Proteintech

Proteintech, 21054-1-AP, THUMPD2 Polyclonal antibody

CATALOG NUMBER: 21054-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The THUMPD2 (21054-1-AP) by Proteintech is a Polyclonal antibody targeting THUMPD2 in WB, IF/ICC, ELISA applications with reactivity to human samples 21054-1-AP targets THUMPD2 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, Jurkat cells, MCF-7 cells Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information THUMP domain-containing protein 2 (THUMPD2) is the methyltransferase, which interacts with an auxiliary protein, TRMT112, to catalyze U6 m2G72 formation. Western blot analysis detected THUMPD2 at an apparent molecular mass of 56 kDa. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13736 Product name: Recombinant human THUMPD2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 125-473 aa of BC004163 Sequence: IEENRDCQLEKQIKEETLEQRDFTTKSEKFQEEEFQNDIEKAIDTHNQNDLTFRVSCRCSGTIGKAFTAQEVGKVIGIAIMKHFGWKADLRNPQLEIFIHLNDIYSVVGIPVFRVSLASRAYIKTAGLRSTIAWAMASLADIKAGAFVLDPMCGLGTILLEAAKEWPDVYYVGADVSDSQLLGTWDNLKAAGLEDKIELLKISVIELPLPSESVDIIISDIPFGKKFKLGKDIKSILQEMERVLHVGGTIVLLLSEDHHRRLTDCKESNIPFNSKDSHTDEPGIKKCLNPEEKTGAFKTASTSFEASNHKFLDRMSPFGSLVPVECYKVSLGKTDAFICKYKKSHSSGL Predict reactive species Full Name: THUMP domain containing 2 Calculated Molecular Weight: 473 aa, 53 kDa Observed Molecular Weight: 56 kDa GenBank Accession Number: BC004163 Gene Symbol: THUMPD2 Gene ID (NCBI): 80745 RRID: AB_3085634 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BTF0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924