Proteintech, 21058-1-AP, LHFPL5 Polyclonal antibody

Size: 20ul / 150ul The LHFPL5 (21058-1-AP) by Proteintech is a Polyclonal antibody targeting LHFPL5 in WB, ELISA applications with reactivity to human, mouse, rat samples 21058-1-AP targets LHFPL5 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse epididymis tissue, rat epididymis tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information LHFPL5 (lipoma HMGIC fusion partner-like 5), previously known as TMHS (tetraspan membrane protein of hair cell stereocilia), is necessary for proper MET channel function. LHFPL5 is a four transmembrane segment protein from the superfamily of tetraspan proteins that includes the claudin tight junction proteins, gap junction proteins, peripheral myelin proteins, and ion channel auxiliary subunits (PMID: 36781873). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14663 Product name: Recombinant human LHFPL5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 66-124 aa of BC028630 Sequence: SYCVGNVLSSELICKGGPLDFSSIPSRAFKTAMFFVALGMFLIIGSIICFSLFFICNTA Predict reactive species Full Name: lipoma HMGIC fusion partner-like 5 Calculated Molecular Weight: 219 aa, 24 kDa Observed Molecular Weight: 28 kDa GenBank Accession Number: BC028630 Gene Symbol: LHFPL5 Gene ID (NCBI): 222662 RRID: AB_3669355 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8TAF8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.