Iright
BRAND / VENDOR: Proteintech

Proteintech, 21071-1-AP, ADORA2B Polyclonal antibody

CATALOG NUMBER: 21071-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The ADORA2B (21071-1-AP) by Proteintech is a Polyclonal antibody targeting ADORA2B in WB, ELISA applications with reactivity to human, mouse samples 21071-1-AP targets ADORA2B in WB, IF, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Specification Tested Reactivity: human, mouse Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15214 Product name: Recombinant human ADORA2B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 278-332 aa of BC025722 Sequence: LSHANSVVNPIVYAYRNRDFRYTFHKIISRYLLCQADVKSGNGQAGVQPALGVGL Predict reactive species Full Name: adenosine A2b receptor Calculated Molecular Weight: 332 aa, 36 kDa Observed Molecular Weight: 36 kDa GenBank Accession Number: BC025722 Gene Symbol: ADORA2B Gene ID (NCBI): 136 RRID: AB_2918069 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P29275 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924