Proteintech, 21078-1-AP, FAM190B Polyclonal antibody

Size: 20ul / 150ul The FAM190B (21078-1-AP) by Proteintech is a Polyclonal antibody targeting FAM190B in WB, IHC, ELISA applications with reactivity to human, mouse samples 21078-1-AP targets FAM190B in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: NIH/3T3 cells, U2OS cells Positive IHC detected in: mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information FAM190B (Family with sequence similarity 190, member B), also known as Gcap14, CCSER2, KIAA1128, NPD012, is a CC domain-containing protein with multiple isoforms generated by alternative splicing that functions as an MAP. FAM190B is a microtubule plus-end-tracking protein and as a regulator of microtubule dynamics during neurodevelopment (PMID: 36795749). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15281 Product name: Recombinant human KIAA1128 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-354 aa of BC030528 Sequence: MPNGTPVNLLGTSKNSNVKSYIKNNGSDCPSSHSFNWRKANKYQLCAQGVEEPNNTQNSHDKIIDPEKRVPTQGMFDKNGIKGGLKSVSLFTSKLAKPSTMFVSSTEELNQKSFSGPSNLGKFTKGTLLGRTSYSSINTPKSQLNGFYGNRSAGSMQRPRANSCATRSSSGESLAQSPDSSKSINCEKMVRSQSFSHSIQNSFLPPSSITRSHSFNRAVDLTKPYQNQQLSIRVPLRSSMLTRNSRQPEVLNGNEHLGYGFNRPYAAGGKKLALPNGPGVTSTLGYRMVHPSLLKSSRSPFSGTMTVDGNKNSPADTCVEEDATVLAKDRAANKDQELIENESYRTKNNQTMKH Predict reactive species Full Name: KIAA1128 Calculated Molecular Weight: 834 aa, 94 kDa Observed Molecular Weight: 63 kDa GenBank Accession Number: BC030528 Gene Symbol: KIAA1128 Gene ID (NCBI): 54462 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H7U1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.