Proteintech, 21090-1-AP, CHCHD4 Polyclonal antibody

Size: 20ul / 150ul The CHCHD4 (21090-1-AP) by Proteintech is a Polyclonal antibody targeting CHCHD4 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 21090-1-AP targets CHCHD4 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Daudi cells, human heart tissue, mouse lung tissue, mouse spleen tissue, L02 cells, mouse kidney tissue, Ramos cells, Raji cells, rat brain tissue, mouse brain tissue Positive IP detected in: mouse brain tissue Positive IHC detected in: mouse testis tissue, human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information CHCHD4, a component of human mitochondria, belongs to a protein family. It functions as chaperone and catalyzes the formation of disulfide bonds in substrate proteins, such as COX17. It is required for the import and folding of small cysteine-containing proteins (small Tim) in the mitochondrial intermembrane space (IMS). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15339 Product name: Recombinant human CHCHD4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-142 aa of BC033775 Sequence: MSYCRQEGKDRIIFVTKEDHETPSSAELVADDPNDPYEEHGLILPNGNINWNCPCLGGMASGPCGEQFKSAFSCFHYSTEEIKGSDCVDQFRAMQECMQKYPDLYPQEDEDEEEEREKKPAEQAEETAPIEATATKEEEGSS Predict reactive species Full Name: coiled-coil-helix-coiled-coil-helix domain containing 4 Calculated Molecular Weight: 142 aa, 16 kDa Observed Molecular Weight: 22 kDa GenBank Accession Number: BC033775 Gene Symbol: CHCHD4 Gene ID (NCBI): 131474 RRID: AB_10734583 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8N4Q1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.