Proteintech, 21094-1-AP, LHFPL4 Polyclonal antibody

Size: 20ul / 150ul The LHFPL4 (21094-1-AP) by Proteintech is a Polyclonal antibody targeting LHFPL4 in WB, ELISA applications with reactivity to human, mouse samples 21094-1-AP targets LHFPL4 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse heart tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information LHFPL4, or Lipoma HMGIC Fusion Partner-Like 4, is a member of the tetraspanin superfamily of transmembrane proteins. LHFPL4 interacts tightly with GABAAR subunits and is selectively enriched at inhibitory synapses. It is important for GABAAR clustering both in vitro and in vivo, and it is required for surface clustering but not the trafficking of GABAARs (PMID: 28978485). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15349 Product name: Recombinant human LHFPL4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 197-247 aa of BC113964 Sequence: LGNRQTDLLQEELKPENKDFVGSTVSSVLRPGGDVSGWGVLPCPVAHSQGP Predict reactive species Full Name: lipoma HMGIC fusion partner-like 4 Calculated Molecular Weight: 247 aa, 27 kDa Observed Molecular Weight: 27 kDa GenBank Accession Number: BC113964 Gene Symbol: LHFPL4 Gene ID (NCBI): 375323 RRID: AB_3669357 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: Q7Z7J7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.