Product Description
Size: 20ul / 150ul
The ANKRD13D (21100-1-AP) by Proteintech is a Polyclonal antibody targeting ANKRD13D in WB, IHC, ELISA applications with reactivity to human samples
21100-1-AP targets ANKRD13D in WB, IHC, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: Jurkat cells, HT-1080 cells
Positive IHC detected in: human small intestine tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Western Blot (WB): WB : 1:200-1:1000
Immunohistochemistry (IHC): IHC : 1:20-1:200
Background Information
ANKRD13D, also named as Ankyrin repeat domain-containing protein 13D, is a 518 amino acid protein, which contains 4 UIM (ubiquitin-interacting motif) repeats. ANKRD13D localizes in the cell membrane and late endosome. ANKRD13D as a ubiquitin-binding protein that specifically recognizes and binds 'Lys-63'-linked ubiquitin. The calculated molecular weight of ANKRD13D is 58kDa, but we decteted a 50kDa protein via western blot. experiment.
Specification
Tested Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag15369 Product name: Recombinant human ANKRD13D protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 284-367 aa of BC110419 Sequence: LSDQDKSRSKAGKTPFQSFLGMAQQHSSHTGAPVQQAASPTNPTAISPEEYFDPNFSLESRNIGRPIEMSSKVQRFKATLWLSE Predict reactive species
Full Name: ankyrin repeat domain 13 family, member D
Calculated Molecular Weight: 605 aa, 68 kDa
Observed Molecular Weight: 50 kDa
GenBank Accession Number: BC110419
Gene Symbol: ANKRD13D
Gene ID (NCBI): 338692
RRID: AB_2878813
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q6ZTN6
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924