Proteintech, 21117-1-AP, SLC44A5 Polyclonal antibody

Size: 20ul / 150ul The SLC44A5 (21117-1-AP) by Proteintech is a Polyclonal antibody targeting SLC44A5 in IHC, ELISA applications with reactivity to human samples 21117-1-AP targets SLC44A5 in IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information The choline transport system has been categorized into three transporter families: Polyspecific organic cation transporters (OCTs/SLC22A1-2) with low affinity for choline, high-affinity choline transporter 1 (CHT1/SLC5A7) and intermediate-affinity choline transporter-like proteins (CTLs/SLC44A1-5). the CTLs/SLC44A1-5 were shown to be present in various human tissues. SLC44A5, also known as CTL5, is an integral membrane protein. SLC44A5 is involved in the membrane-spanning transport of choline. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15459 Product name: Recombinant human SLC44A5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 42-211 aa of BC051740 Sequence: TPNENKTILFYFNLLRCTSPSVLLNLQCPTTQICVSKCPEKFLTYVEMQLLYTKDKSYWEDYRQFCKTTAKPVKSLTQLLLDDDCPTAIFPSKPFLQRCFPDFSTKNGTLTIGSKMMFQDGNGGTRSVVELGIAANGINKLLDAKSLGLKVFEDYARTWYWILIGLTIAM Predict reactive species Full Name: solute carrier family 44, member 5 Calculated Molecular Weight: 719 aa, 82 kDa GenBank Accession Number: BC051740 Gene Symbol: SLC44A5 Gene ID (NCBI): 204962 RRID: AB_3669360 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8NCS7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.