Iright
BRAND / VENDOR: Proteintech

Proteintech, 21131-1-AP, Ceruloplasmin Polyclonal antibody

CATALOG NUMBER: 21131-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The Ceruloplasmin (21131-1-AP) by Proteintech is a Polyclonal antibody targeting Ceruloplasmin in WB, IHC, ELISA applications with reactivity to human, mouse samples 21131-1-AP targets Ceruloplasmin in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: human blood tissue, mouse brain tissue, human plasma tissue Positive IHC detected in: human tonsillitis tissue, human colon tissue, human hepatocirrhosis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:400-1:1600 Background Information Ceruloplasmin (CP) is a serum glycoprotein synthesized by hepatocytes and functions as the major transport protein of copper in blood where it acts as ferrodoxidase and is required for iron transport of transferrin. The intact ceruloplasmin migrated around 130-140 kDa and some proteolytic cleaved fragments could also be observed. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, chicken Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15535 Product name: Recombinant human CP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 194-446 aa of BC146663 Sequence: IGPLIICKKDSLDKEKEKHIDREFVVMFSVVDENFSWYLEDNIKTYCSEPEKVDKDNEDFQESNRMYSVNGYTFGSLPGLSMCAEDRVKWYLFGMGNEVDVHAAFFHGQALTNKNYRIDTINLFPATLFDAYMVAQNPGEWMLSCQNLNHLKAGLQAFFQVQECNKSSSKDNIRGKHVRHYYIAAEEIIWNYAPSGIDIFTKENLTAPGSDSAVFFEQGTTRIGGSYKKLVYREYTDASFTNRKERGPEEEHL Predict reactive species Full Name: ceruloplasmin (ferroxidase) Calculated Molecular Weight: 1065 aa, 122 kDa Observed Molecular Weight: 130-140 kDa, 85 kDa GenBank Accession Number: BC146663 Gene Symbol: Ceruloplasmin Gene ID (NCBI): 1356 RRID: AB_2878815 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P00450 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924