Iright
BRAND / VENDOR: Proteintech

Proteintech, 21136-1-AP, Fibulin-7 Polyclonal antibody

CATALOG NUMBER: 21136-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The Fibulin-7 (21136-1-AP) by Proteintech is a Polyclonal antibody targeting Fibulin-7 in WB, ELISA applications with reactivity to human, pig samples 21136-1-AP targets Fibulin-7 in WB, ELISA applications and shows reactivity with human, pig samples. Tested Applications Positive WB detected in: pig cartilage tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information Fibulins are a family of extracellular matrix glycoproteins associated with basement membranes, elastic fibers, and other matrices (PMID: 19189051). The family members are defined by the presence of two structural modules, a tandem repeat of epidermal growth factor-like modules, and a unique C-terminal fibulin-type module (PMID: 19189051). They play an important role in regulating multiple cellular functions such as adhesion, growth, motility, and survival (PMID: 32429873). Fibulin-7, also named as TM14, was first identified in the mouse tooth germ cDNA microarray by differential hybridization (PMID: 17699513). Fibulin-7 is expressed in developing odontoblasts, in the giant trophoblast layer of the placenta, in the choroid of the eyes as well as in the cartilage (PMID: 32429873). It plays important roles in both the differentiation and maintenance of odontoblasts as well as in dentin formation. Specification Tested Reactivity: human, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15564 Product name: Recombinant human FBLN7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 90-439 aa of BC035784 Sequence: GRKFGSKYLVDHEVHFTCNPGFRLVGPSSVVCLPNGTWTGEQPHCRGISECSSQPCQNGGTCVEGVNQYRCICPPGRTGNRCQHQAQTAAPEGSVAGDSAFSRAPRCAQVERAQHCSCEAGFHLSGAAGDSVCQDVNECELYGQEGRPRLCMHACVNTPGSYRCTCPGGYRTLADGKSCEDVDECVGLQPVCPQGTTCINTGGSFQCVSPECPEGSGNVSYVKTSPFQCERNPCPMDSRPCRHLPKTISFHYLSLPSNLKTPITLFRMATASAPGRAGPNSLRFGIVGGNSRGHFVMQRSDRQTGDLILVQNLEGPQTLEVDVDMSEYLDRSFQANHVSKVTIFVSPYDF Predict reactive species Full Name: fibulin 7 Calculated Molecular Weight: 439 aa, 47 kDa Observed Molecular Weight: 47 kDa GenBank Accession Number: BC035784 Gene Symbol: Fibulin-7 Gene ID (NCBI): 129804 RRID: AB_3085638 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: Q53RD9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924