Iright
BRAND / VENDOR: Proteintech

Proteintech, 21139-1-AP, GALNT1 Polyclonal antibody

CATALOG NUMBER: 21139-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The GALNT1 (21139-1-AP) by Proteintech is a Polyclonal antibody targeting GALNT1 in WB, ELISA applications with reactivity to human, mouse, rat samples 21139-1-AP targets GALNT1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: BGC-823 cells, HepG2 cells, HuH-7 cells, MKN-45 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information N-acetylgalactosaminyltransferase 1 (GALNT1) is a member of a large family of Golgi resident polypeptide GALNT that initiate mucin-type O-glycosylation by transfer of α-GalNAc from UDP-GalNAc to serine or threonine residues of proteins. GALNT1 is frequently up-regulated in HCC and gastric cancer, and higher GALNT1 expression levels are associated with poorer overall survival (PMID: 25730904, 36439876). The antibody against GALNT1 recognized a specific band at 64 kDa. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15591 Product name: Recombinant human GALNT1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 316-499 aa of BC038440 Sequence: EFKNFFYIISPGVTKVDYGDISSRVGLRHKLQCKPFSWYLENIYPDSQIPRHYFSLGEIRNVETNQCLDNMARKENEKVGIFNCHGMGGNQVFSYTANKEIRTDDLCLDVSKLNGPVTMLKCHHLKGNQLWEYDPVKLTLQHVNSNQCLDKATEEDSQVPSIRDCNGSRSQQWLLRNVTLPEIF Predict reactive species Full Name: UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 1 (GalNAc-T1) Calculated Molecular Weight: 559 aa, 64 kDa Observed Molecular Weight: 64 kDa GenBank Accession Number: BC038440 Gene Symbol: GALNT1 Gene ID (NCBI): 2589 RRID: AB_3085639 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q10472 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924