Iright
BRAND / VENDOR: Proteintech

Proteintech, 21141-1-AP, ITIH1 Polyclonal antibody

CATALOG NUMBER: 21141-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The ITIH1 (21141-1-AP) by Proteintech is a Polyclonal antibody targeting ITIH1 in WB, ELISA applications with reactivity to human, mouse, rat samples 21141-1-AP targets ITIH1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse auricular cartilage tissue, mouse cartilage tissue, rat auricular cartilage tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information ITIH1 (inter-alpha-trypsin inhibitor heavy chain 1), also named as IGHEP1 and SHAP. It is a key component of the inter-alpha-trypsin inhibitor (ITI) family, which plays a crucial role in extracellular matrix (ECM) stabilization and inflammation regulation. ITIH1 forms a complex with bikunin (a light chain) and other heavy chains (ITIH2, ITIH3, ITIH4), contributing to the stabilization of hyaluronan-rich matrices. The calculated molecular weight of the ITIH1 mature form is 101 kDa, but the actual observed molecular weight is about 76 kDa (PMID: 9677337). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15598 Product name: Recombinant human ITIH1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 608-811 aa of BC069464 Sequence: SMSIRGMADQDGLKPTIDKPSEDSPPLEMLGPRRTFVLSALQPSPTHSSSNTQRLPDRVTGVDTDPHFIIHVPQKEDTLCFNINEEPGVILSLVQDPNTGFSVNGQLIGNKARSPGQHDGTYFGRLGIANPATDFQLEVTPQNITLNPGFGGPVFSWRDQAVLRQDGVVVTINKKRNLVVSVDDGGTFEVVLHRVWKGSSVHQD Predict reactive species Full Name: inter-alpha (globulin) inhibitor H1 Calculated Molecular Weight: 911 aa, 101 kDa Observed Molecular Weight: 70-76 kDa GenBank Accession Number: BC069464 Gene Symbol: ITIH1 Gene ID (NCBI): 3697 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P19827 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924