Iright
BRAND / VENDOR: Proteintech

Proteintech, 21159-1-AP, TEAD2 Polyclonal antibody

CATALOG NUMBER: 21159-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The TEAD2 (21159-1-AP) by Proteintech is a Polyclonal antibody targeting TEAD2 in WB, ELISA applications with reactivity to human, mouse samples 21159-1-AP targets TEAD2 in WB, IHC, ChIP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse colon tissue, mouse lung tissue Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Background Information TEAD2 belongs to a protein family that share the TEA/ATTS domain. It acts as a transcriptional factor by cooperatively binding to the GT-IIC and Sph(I 1 II) enhansons in the simian virus 40 (SV40) enhancer. Also it can modulate SV40 late transcription together with large T antigen. The transcriptional activity of TEAD2 required several regions of the proteins , a TBP-associated factors and a limiting transcriptional intermediary factors. TEAD2 also preforms an essential role in the Hippo signaling pathway. TEAD2 regulates gene expression of YAP1 and WWTR1/TAZ, thus mediating cell proliferation, migration and epithelial mesenchymal transition induction. TEAD2 is strongly expressed in human ovarian carcinoma cell line. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14074 Product name: Recombinant human TEAD2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 121-251 aa of BC051301 Sequence: DQVSKDKAFQTMATMSSAQLISAPSLQAKLGPTGPQVVQASELFQFWSGGSGPPWNVPDVKPFSQTPFTLSLTPPSTDLPGYEPPQALSPLPPPTPSPPAWQARGLGTARLQLVEFSAFVEPPDAVDSYQR Predict reactive species Full Name: TEA domain family member 2 Calculated Molecular Weight: 447 aa, 49 kDa Observed Molecular Weight: 55-65 kDa GenBank Accession Number: BC051301 Gene Symbol: TEAD2 Gene ID (NCBI): 8463 RRID: AB_2861186 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q15562 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924