Proteintech, 21163-1-AP, TRIP6 Polyclonal antibody

Size: 20ul / 150ul The TRIP6 (21163-1-AP) by Proteintech is a Polyclonal antibody targeting TRIP6 in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 21163-1-AP targets TRIP6 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, human testis tissue, mouse lung tissue Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100 Background Information TRIP6 (thyroid receptor-interacting protein 6), also known as ZRP-1 (zyxin-related protein 1), is a member of the zyxin family that has been implicated in actin reorganization and cell motility. Trip6 has been proposed to transport signals from the cell surface to the nucleus. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15149 Product name: Recombinant human TRIP6 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 127-476 aa of BC004249 Sequence: PPPAYRTGSLKPNPASPLPASPYGGPTPASYTTASTPAGPAFPVQVKVAQPVRGCGPPRRGASQASGPLPGPHFPLPGRGEVWGPGYRSQREPGPGAKEEAAGVSGPAGRGRGGEHGPQVPLSQPPEDELDRLTKKLVHDMNHPPSGEYFGQCGGCGEDVVGDGAGVVAFDRVFHVGCFVCSTCRAQLRGQHFYAVERRAYCEGCYVATLEKCATCSQPILDRILRAMGKAYHPGCFTCVVCHRGLDGIPFTVDATSQIHCIEDFHRKFAPRCSVCGGAIMPEPGQEETVRIVALDRSFHIGCYKCEECGLLLSSEGECQGCYPLDGHILCKACSAWRIQELSATVTTDC Predict reactive species Full Name: thyroid hormone receptor interactor 6 Calculated Molecular Weight: 476 aa, 50 kDa Observed Molecular Weight: 50-55 kDa GenBank Accession Number: BC004249 Gene Symbol: TRIP6 Gene ID (NCBI): 7205 RRID: AB_10732813 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q15654 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.