Proteintech, 21165-1-AP, HTR4 Polyclonal antibody

Size: 20ul / 150ul The HTR4 (21165-1-AP) by Proteintech is a Polyclonal antibody targeting HTR4 in IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 21165-1-AP targets HTR4 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: human prostate hyperplasia tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Specification Tested Reactivity: human, mouse Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15226 Product name: Recombinant human HTR4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 301-388 aa of BC074755 Sequence: GYINSGLNPFLYAFLNKSFRRAFLIILCCDDERYRRPSILGQTVPCSTTTINGSTHVLRDAVECGGQWESQCHPPATSPLVAAQPSDT Predict reactive species Full Name: 5-hydroxytryptamine (serotonin) receptor 4 Calculated Molecular Weight: 388 aa, 44 kDa GenBank Accession Number: BC074755 Gene Symbol: HTR4 Gene ID (NCBI): 3360 RRID: AB_11182374 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q13639 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.