Iright
BRAND / VENDOR: Proteintech

Proteintech, 21166-1-AP, MKL1/MRTF-A Polyclonal antibody

CATALOG NUMBER: 21166-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The MKL1/MRTF-A (21166-1-AP) by Proteintech is a Polyclonal antibody targeting MKL1/MRTF-A in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 21166-1-AP targets MKL1/MRTF-A in WB, IHC, IF/ICC, ChIP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, HepG2 cells Positive IHC detected in: human small intestine tissue, human tonsillitis tissue, human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: U-251 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Megakaryocytic leukemia 1 (MKL1), also known as myocardin-related transcription factor A (MRTF-A), is a transcriptional regulator involved in a wide range of pathophysiological processes in the cardiovascular system. MKL1 was initially identified as a co-factor for serum response factor (SRF) to regulate the transcription of contractile genes. Forced expression of MKL1 in non-muscle cells leads to robust up-regulation of contractile genes (PMID: 36587486, PMID: 37199168, PMID: 39222836). MKL1 is ubiquitously expressed and has been detected in lung, placenta, small intestine, liver, kidney, spleen, thymus, colon, muscle, heart, and brain. The molecular weight of MKL1 observed is consistent with what has been described in the literature (PMID: 34944031). Specification Tested Reactivity: human Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15240 Product name: Recombinant human MKL1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 392-741 aa of BC115039 Sequence: KAPAATSILHKAGEVVVAFPAARLSTGPALVAAGLAPAEVVVATVASSGVVKFGSTGSTPPVSPTPSERSLLSTGDENSTPGDTFGEMVTSPLTQLTLQASPLQILVKEEGPRAGSCCLSPGGRAELEGRDKDQMLQEKDKQIEALTRMLRQKQQLVERLKLQLEQEKRAQQPAPAPAPLGTPVKQENSFSSCQLSQQPLGPAHPFNPSLAAPATNHIDPCAVAPGPPSVVVKQEALQPEPEPVPAPQLLLGPQGPGLIKGVAPPTLITDSTGTHLVLTVTNKNADSPGLSSGSPQQPSSQPGSPAPAPSAQMDLEHPLQPLFGTPTSLLKKEPPGYEEAMSQQPKQQEN Predict reactive species Full Name: megakaryoblastic leukemia (translocation) 1 Calculated Molecular Weight: 931 aa, 99 kDa Observed Molecular Weight: 145 kDa GenBank Accession Number: BC115039 Gene Symbol: MKL1 Gene ID (NCBI): 57591 RRID: AB_2878822 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q969V6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924