Proteintech, 21188-1-AP, TAOK2 Polyclonal antibody

Size: 20ul / 150ul The TAOK2 (21188-1-AP) by Proteintech is a Polyclonal antibody targeting TAOK2 in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples 21188-1-AP targets TAOK2 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, HEK-293 cells, L02 cells Positive IP detected in: HEK-293 cells Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information TAOK2(Serine/threonine-protein kinase TAO2) is also named as KIAA0881, MAP3K17, PSK, PSK1 and belongs to the protein kinase superfamily. TAOK2 is known to modulate gene transcription via its activation of several MAP kinase pathways, including c-Jun amino-terminal kinase (JNK), and has been implicated in the modulation of actin and microtubule dynamics. The time course of TAOK2 expression is consistent with a role for it in neuronal differentiation.(PMID:22735514). The immunogen of this antibody is 742-969 aa of human TAOK2 protein isoform Alpha.This antibody mainly detects the isoform 1/3/4. It can't detect the isoform 2. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, monkey Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15521 Product name: Recombinant human TAOK2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 742-969 aa of BC142663 Sequence: SLKVRAGQRPPGLPLPIPGALGPPNTGTPIEQQPCSPGQEAVLDQRMLGEEEEAVGERRILGKEGATLEPKQQRILGEESGAPSPSPQKHGSLVDEEVWGLPEEIEELRVPSLVPQERSIVGQEEAGTWSLWGKEDESLLDEEFELGWVQGPALTPVPEEEEEEEEGAPIGTPRDPGDGCPSPDIPPEPPPTHLRPCPASQLPGLLSHGLLAGLSFAVGSSSGLLPLL Predict reactive species Full Name: TAO kinase 2 Calculated Molecular Weight: 1235 aa, 138 kDa Observed Molecular Weight: 138-150 kDa GenBank Accession Number: BC142663 Gene Symbol: TAOK2 Gene ID (NCBI): 9344 RRID: AB_10755293 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UL54 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.