Iright
BRAND / VENDOR: Proteintech

Proteintech, 21199-1-AP, KLHL35 Polyclonal antibody

CATALOG NUMBER: 21199-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • ddddd

    99 xxxxxx

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The KLHL35 (21199-1-AP) by Proteintech is a Polyclonal antibody targeting KLHL35 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 21199-1-AP targets KLHL35 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, mouse kidney tissue, rat brain tissue, rat kidney tissue Positive IHC detected in: human heart tissue, mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: Hela cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15558 Product name: Recombinant human KLHL35 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 230-363 aa of BC042952 Sequence: RQGGVNTDKVQCFDPKEDRWSLRSPAPFSQRCLEAVSLEDTIYVMGGLMSKIFTYDPGTDVWGEAAVLPSPVESCGVTVCDGKVHILGGRDDRGESTDKVFTFDPSSGQVEVQPSLQRCTSSHGCVTIIQSLGR Predict reactive species Full Name: kelch-like 35 (Drosophila) Calculated Molecular Weight: 363 aa, 40 kDa Observed Molecular Weight: 40-45 kDa GenBank Accession Number: BC042952 Gene Symbol: KLHL35 Gene ID (NCBI): 283212 RRID: AB_10693685 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6PF15 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924