Product Description
Size: 20ul / 150ul
The KLHL35 (21199-1-AP) by Proteintech is a Polyclonal antibody targeting KLHL35 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples
21199-1-AP targets KLHL35 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive WB detected in: mouse brain tissue, mouse kidney tissue, rat brain tissue, rat kidney tissue
Positive IHC detected in: human heart tissue, mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Positive IF/ICC detected in: Hela cells
Recommended dilution
Western Blot (WB): WB : 1:1000-1:6000
Immunohistochemistry (IHC): IHC : 1:20-1:200
Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100
Specification
Tested Reactivity: human, mouse, rat
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag15558 Product name: Recombinant human KLHL35 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 230-363 aa of BC042952 Sequence: RQGGVNTDKVQCFDPKEDRWSLRSPAPFSQRCLEAVSLEDTIYVMGGLMSKIFTYDPGTDVWGEAAVLPSPVESCGVTVCDGKVHILGGRDDRGESTDKVFTFDPSSGQVEVQPSLQRCTSSHGCVTIIQSLGR Predict reactive species
Full Name: kelch-like 35 (Drosophila)
Calculated Molecular Weight: 363 aa, 40 kDa
Observed Molecular Weight: 40-45 kDa
GenBank Accession Number: BC042952
Gene Symbol: KLHL35
Gene ID (NCBI): 283212
RRID: AB_10693685
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q6PF15
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924