Iright
BRAND / VENDOR: Proteintech

Proteintech, 21209-1-AP, CCDC25 Polyclonal antibody

CATALOG NUMBER: 21209-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The CCDC25 (21209-1-AP) by Proteintech is a Polyclonal antibody targeting CCDC25 in WB, IHC, ELISA applications with reactivity to human, rat samples 21209-1-AP targets CCDC25 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: A549 cells, HeLa cells, rat brain tissue, Jurkat cells, K-562 cells, MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Specification Tested Reactivity: human, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15593 Product name: Recombinant human CCDC25 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-140 aa of BC032588 Sequence: MDCAHLVKANSIQGCKMNNVNVVYTPWSNLKKTADMDVGQIGFHRQKDVKIVTVEKKVNEILNRLEKTKVERFPDLAAEKECRDREERNEKKAQIQEMKKREKEEMKKKREMDELRSYSSLMKVENMSSNQDGNDSDEFM Predict reactive species Full Name: coiled-coil domain containing 25 Calculated Molecular Weight: 208 aa, 24 kDa Observed Molecular Weight: 24-26 kDa GenBank Accession Number: BC032588 Gene Symbol: CCDC25 Gene ID (NCBI): 55246 RRID: AB_10732690 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q86WR0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924