Iright
BRAND / VENDOR: Proteintech

Proteintech, 21211-1-AP, Mammaglobin B Polyclonal antibody

CATALOG NUMBER: 21211-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The Mammaglobin B (21211-1-AP) by Proteintech is a Polyclonal antibody targeting Mammaglobin B in IHC, ELISA applications with reactivity to human samples 21211-1-AP targets Mammaglobin B in IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human ovary tumor tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Mammaglobin B, also referred to as secretoglobin family 2A member 1 (SCGB2A1), is a member of the uteroglobin superfamily. SCGB2A1 has been identified as a candidate biomarker for the detection of lymph node micrometastases in breast cancer and abdominal cancer types. SCGB2A1 has been considered as a promising diagnostic marker for occult tumor cells in effusions of several malignancies and as a potential immunotherapeutic target in ovarian cancer. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15609 Product name: Recombinant human Mammaglobin protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 50-95 aa of BC062218 Sequence: IDSDAAAEAMGKFKQCFLNQSHRTLKNFGLMMHTVYDSIWCNMKSN Predict reactive species Full Name: secretoglobin, family 2A, member 1 Calculated Molecular Weight: 95 aa, 11 kDa GenBank Accession Number: BC062218 Gene Symbol: Mammaglobin B Gene ID (NCBI): 4246 RRID: AB_3085644 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O75556 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924