Proteintech, 21220-1-AP, AAMP Polyclonal antibody

Size: 20ul / 150ul The AAMP (21220-1-AP) by Proteintech is a Polyclonal antibody targeting AAMP in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 21220-1-AP targets AAMP in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HUVEC cells, human heart tissue, mouse kidney tissue, mouse lung tissue, MCF-7 cells Positive IHC detected in: human liver cancer tissue, human hepatocirrhosis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15655 Product name: Recombinant human AAMP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 85-434 aa of BC039866 Sequence: VTFALHSASVFCVSLDPKTNTLAVTGGEDDKAFVWRLSDGELLFECAGHKDSVTCAGFSHDSTLVATGDMSGLLKVWQVDTKEEVWSFEAGDLEWMEWHPRAPVLLAGTADGNTWMWKVPNGDCKTFQGPNCPATCGRVLPDGKRAVVGYEDGTIRIWDLKQGSPIHVLKGTEGHQGPLTCVAANQDGSLILTGSVDCQAKLVSATTGKVVGVFRPETVASQPSLGEGEESESNSVESLGFCSVMPLAAVGYLDGTLAIYDLATQTLRHQCQHQSGIVQLLWEAGTAVVYTCSLDGIVRLWDARTGRLLTDYRGHTAEILDFALSKDASLVVTTSGDHKAKVFCVQRPDR Predict reactive species Full Name: angio-associated, migratory cell protein Calculated Molecular Weight: 434 aa, 47 kDa Observed Molecular Weight: 52-58 kDa GenBank Accession Number: BC039866 Gene Symbol: AAMP Gene ID (NCBI): 14 RRID: AB_10733642 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q13685 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.