Iright
BRAND / VENDOR: Proteintech

Proteintech, 21221-1-AP, ZNF816 Polyclonal antibody

CATALOG NUMBER: 21221-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The ZNF816 (21221-1-AP) by Proteintech is a Polyclonal antibody targeting ZNF816 in IHC, IF/ICC, ELISA applications with reactivity to human samples 21221-1-AP targets ZNF816 in IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: U-251 cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information ZNF816 ( Zinc finger protein 816), a direct target of ZBED4, was found to interact with multiple FDA-approved immunomodulatory agents, suggesting a potential ZBED4-ZNF816 regulatory axis with translational value. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15658 Product name: Recombinant human ZNF816A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 399-506 aa of BC105930 Sequence: CEECDNVYIRRSHLERHRKIHTGEGSYKCKVCDKVFRSDSYLAEHQRVHTGEKPYKCNKCGRSFSRKSSLQYHHTLHTGEKPYTCNECGKVFSRRENLARHHRLHAGE Predict reactive species Full Name: zinc finger protein 816A Calculated Molecular Weight: 651 aa, 76 kDa GenBank Accession Number: BC105930 Gene Symbol: ZNF816A Gene ID (NCBI): 125893 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q0VGE8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924