Proteintech, 21224-1-AP, MORN2 Polyclonal antibody

Size: 20ul / 150ul The MORN2 (21224-1-AP) by Proteintech is a Polyclonal antibody targeting MORN2 in IHC, ELISA applications with reactivity to human, mouse samples 21224-1-AP targets MORN2 in IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information (MORN2 is a testis-enriched protein and its initial expression coincides with the first wave of meiosis. MORN2 functions in the dynamic regulation of acrosome biogenesis during late spermiogenesis, and MORN2 has been shown to function in LC3-associated phagocytosis and in resistance to bacterial infection in planarians. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15665 Product name: Recombinant human MORN2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-79 aa of BC102035 Sequence: MNGFGRLEHFSGAVYEGQFKDNMFHGLGTYTFPNGAKYTGNFNENRVEGEGEYTDIQGLEWSGNFHFTAAPDLKLKLHM Predict reactive species Full Name: MORN repeat containing 2 Calculated Molecular Weight: 79 aa, 9 kDa GenBank Accession Number: BC102035 Gene Symbol: MORN2 Gene ID (NCBI): 729967 RRID: AB_3669362 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q502X0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.