Iright
BRAND / VENDOR: Proteintech

Proteintech, 21229-1-AP, USB1 Polyclonal antibody

CATALOG NUMBER: 21229-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The USB1 (21229-1-AP) by Proteintech is a Polyclonal antibody targeting USB1 in WB, ELISA applications with reactivity to human samples 21229-1-AP targets USB1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, Calu-1 cells, HeLa cells, Jurkat cells, K-562 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information USB1 (U6 snRNA biogenesis phosphodiesterase 1) is a key nuclease primarily located within the nucleus and responsible for RNA processing. Its most well-defined function is to catalyze the hydrolysis of the 2',3'-cyclic phosphate at the 3' end of the U6 small nuclear RNA (snRNA), generating an essential 3'-hydroxyl group. This process is crucial for spliceosome assembly and pre-mRNA splicing. Mutations in the USB1 gene directly cause cartilaginous-hair hypoplasia, a rare autosomal recessive genetic disorder. Affected individuals present with short-limbed dwarfism, sparse hair, immunodeficiency, and bone marrow failure, revealing the critical roles of USB1 in skeletal development, cell cycle regulation, and immune system function. Therefore, USB1 is not only a core factor in RNA metabolism but also an important disease-associated protein. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15689 Product name: Recombinant human C16orf57 protein Source: e coli. -derived, PKG Tag: GST Domain: 1-265 aa of BC004415 Sequence: MSAAPLVGYSSSGSEDESEDGMRTRPGDGSHRRGQSPLPRQRFPVPDSVLNMFPGTEEGPEDDSTKHGGRVRTFPHERGNWATHVYVPYEAKEEFLDLLDVLLPHAQTYVPRLVRMKVFHLSLSQSVVLRHHWILPFVQALKARMTSFHRFFFTANQVKIYTNQEKTRTFIGLEVTSGHAQFLDLVSEVDRVMEEFNLTTFYQDPSFHLSLAWCVGDARLQLEGQCLQELQAIVDGFEDAEVLLRVHTEQVRCKSGNKFFSMPLK Predict reactive species Full Name: chromosome 16 open reading frame 57 Calculated Molecular Weight: 265 aa, 30 kDa Observed Molecular Weight: 31 kDa GenBank Accession Number: BC004415 Gene Symbol: C16orf57 Gene ID (NCBI): 79650 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BQ65 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924