Proteintech, 21232-1-AP, TAC4 Polyclonal antibody

Size: 20ul / 150ul The TAC4 (21232-1-AP) by Proteintech is a Polyclonal antibody targeting TAC4 in IHC, ELISA applications with reactivity to human, mouse samples 21232-1-AP targets TAC4 in IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: mouse lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information TAC4, or tachykinin 4, is a gene that encodes for a member of the tachykinin family of peptides, which are known for their rapid stimulation of contraction in intestinal muscles and other physiological functions. The tachykinin family includes three members in mammals: TAC1, TAC3, and TAC4. TAC4, in particular, is involved in a variety of physiological roles and has been implicated in several biological processes. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15702 Product name: Recombinant human TAC4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-57 aa of BC111858 Sequence: MLPCLALLLLMELSVCTVAGDGGEEQTLSTEAETWEGAGPSIQLQLQEVKTGKASQF Predict reactive species Full Name: tachykinin 4 (hemokinin) Calculated Molecular Weight: 113 aa, 12 kDa GenBank Accession Number: BC111858 Gene Symbol: TAC4 Gene ID (NCBI): 255061 RRID: AB_3669363 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q86UU9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.