Iright
BRAND / VENDOR: Proteintech

Proteintech, 21243-1-AP, EPS15R Polyclonal antibody

CATALOG NUMBER: 21243-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The EPS15R (21243-1-AP) by Proteintech is a Polyclonal antibody targeting EPS15R in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 21243-1-AP targets EPS15R in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: BxPC-3 cells, MCF-7 cells, HEK-293 cells, Y79 cells Positive IHC detected in: human intrahepatic cholangiocarcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: BxPC-3 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:14000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information EPS15R is a protein that belongs to the Eps15 family of proteins, which are known for their roles in intracellular trafficking, particularly in the regulation of endocytosis and vesicle formation. EPS15R, like other members of the Eps15 family, functions as a scaffolding adaptor protein and is involved in both secretion and endocytosis. It has been shown to bind to AP-1 and AP-2 complexes, inositol lipids, and several other proteins that are crucial for the regulation of intracellular trafficking. EPS15R is also implicated in the regulation of membrane morphology, which is essential for intracellular vesicle formation and trafficking . It has been detected in the nucleus of mammalian cells, and its activation through growth factor receptors induces tyrosine phosphorylation and mono-ubiquitination, although the specific roles of these post-translational modifications are not yet fully understood Specification Tested Reactivity: human Cited Reactivity: human, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15735 Product name: Recombinant human EPS15L1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 351-597 aa of BC142716 Sequence: PQVLSPDMVPPSERGTPGPDSSGSLGSGEFTGVKELDDISQEIAQLQREKYSLEQDIREKEEAIRQKTSEVQELQNDLDRETSSLQELEAQKQDAQDRLDEMDQQKAKLRDMLSDVRQKCQDETQMISSLKTQIQSQESDLKSQEDDLNRAKSELNRLQQEETQLEQSIQAGRVQLETIIKSLKSTQDEINQARSKLSQLHESRQEAHRSLEQYDQVLDGAHGASLTDLANLSEGVSLAERGSFGAM Predict reactive species Full Name: epidermal growth factor receptor pathway substrate 15-like 1 Calculated Molecular Weight: 864 aa, 94 kDa Observed Molecular Weight: 94 kDa GenBank Accession Number: BC142716 Gene Symbol: EPS15R Gene ID (NCBI): 58513 RRID: AB_10733643 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UBC2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924