Proteintech, 21244-1-AP, ER Polyclonal antibody

Size: 20ul / 150ul The ER (21244-1-AP) by Proteintech is a Polyclonal antibody targeting ER in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 21244-1-AP targets ER in WB, IHC, IF/ICC, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, mouse testis tissue, NIH/3T3 cells, rat testis tissue, MCF-7 cells Positive IHC detected in: human cervical cancer tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:200-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information The estrogen receptor (ESR, ER) is a ligand-activated transcription factor composed of several domains important for hormone binding, DNA binding, and activation of transcription. ESR1, also known as ESR or NR3A1, belongs to the nuclear hormone receptor family and NR3 subfamily. It is a nuclear hormone receptor. The steroid hormones and their receptors are involved in the regulation of eukaryotic gene expression and affect cellular proliferation and differentiation in target tissues. ESR1 can activate the transcriptional activity of TFF1.[PMID: 11731608,10970861] Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, bovine, sheep, goat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15738 Product name: Recombinant human ER protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 65-280 aa of BC128573 Sequence: AAAANAQVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQLSPFLQPHGQQVPYYLENEPSGYTVREAGPPAFYRPNSDNRRQGGRERLASTNDKGSMAMESAKETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDKNRRKSCQACRLRKCYEVGMMKGGIRKDRRGGRMLKHKRQRDDGEGRGEV Predict reactive species Full Name: estrogen receptor 1 Calculated Molecular Weight: 595 aa, 66 kDa Observed Molecular Weight: 65-70 kDa GenBank Accession Number: BC128573 Gene Symbol: ER Gene ID (NCBI): 2099 RRID: AB_11042600 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P03372 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.