Proteintech, 21245-1-AP, SYT2 Polyclonal antibody

Size: 20ul / 150ul The SYT2 (21245-1-AP) by Proteintech is a Polyclonal antibody targeting SYT2 in WB, IF-P, ELISA applications with reactivity to human, mouse, rat samples 21245-1-AP targets SYT2 in WB, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, mouse cerebellum tissue, rat brain tissue, Neuro-2a cells Positive IF-P detected in: mouse cerebellum tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information SYT2 (Synaptotagmin-2) a synaptic vesicle membrane protein, functions as a calcium sensor in vesicular trafficking and exocytosis. SYT2 is also plays a role in dendrite formation by melanocytes (PMID: 23999003). Mutations in SYT2 are associated with myasthenic syndrome, presynaptic, congenital, with or without motor neuropathy. SYT2 mutations cause a complex presynaptic congenital myasthenic syndrome (PMID: 26519543). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15744 Product name: Recombinant human SYT2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-60 aa of BC100815 Sequence: MRNIFKRNQEPIVAPATTTATMPIGPVDNSTESGGAGESQEDMFAKLKEKLFNEINKIPL Predict reactive species Full Name: synaptotagmin II Calculated Molecular Weight: 419 aa, 47 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: BC100815 Gene Symbol: SYT2 Gene ID (NCBI): 127833 RRID: AB_3085646 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8N9I0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.