Product Description
Size: 20ul / 150ul
The HMGB3L1 (21246-1-AP) by Proteintech is a Polyclonal antibody targeting HMGB3L1 in WB, ELISA applications with reactivity to human samples
21246-1-AP targets HMGB3L1 in WB, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: HeLa cells, human placenta tissue
Recommended dilution
Western Blot (WB): WB : 1:500-1:1000
Specification
Tested Reactivity: human
Cited Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag15748 Product name: Recombinant human HMGB3L1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 54-118 aa of BC103851 Sequence: MWNNLNDSEKQPYVTKVAKLKKYEKDVADYKSKGKLDGTKGPAKVAWEKMEEEDEEDGEEEKEDE Predict reactive species
Full Name: high-mobility group box 3-like 1
Calculated Molecular Weight: 130 aa, 15 kDa
Observed Molecular Weight: 28-31 kDa
GenBank Accession Number: BC103851
Gene Symbol: HMGB3L1
Gene ID (NCBI): 128872
RRID: AB_2878829
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924