Proteintech, 21246-1-AP, HMGB3L1 Polyclonal antibody

Size: 20ul / 150ul The HMGB3L1 (21246-1-AP) by Proteintech is a Polyclonal antibody targeting HMGB3L1 in WB, ELISA applications with reactivity to human samples 21246-1-AP targets HMGB3L1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, human placenta tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15748 Product name: Recombinant human HMGB3L1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 54-118 aa of BC103851 Sequence: MWNNLNDSEKQPYVTKVAKLKKYEKDVADYKSKGKLDGTKGPAKVAWEKMEEEDEEDGEEEKEDE Predict reactive species Full Name: high-mobility group box 3-like 1 Calculated Molecular Weight: 130 aa, 15 kDa Observed Molecular Weight: 28-31 kDa GenBank Accession Number: BC103851 Gene Symbol: HMGB3L1 Gene ID (NCBI): 128872 RRID: AB_2878829 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.