Iright
BRAND / VENDOR: Proteintech

Proteintech, 21252-1-AP, FABP2 Polyclonal antibody

CATALOG NUMBER: 21252-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The FABP2 (21252-1-AP) by Proteintech is a Polyclonal antibody targeting FABP2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 21252-1-AP targets FABP2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: COLO 320 cells, mouse small intestine tissue, rat small intestine tissue Positive IHC detected in: human stomach cancer tissue, human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information FABP2, also known as Intestinal Fatty Acid Binding Protein (I-FABP), is a member of the Fatty Acid Binding Proteins (FABPs) family. The cytoplasmic content of FABP2 could be delivered into the systematic circulation once the death of enterocyte happens, thus the elevated FABP2 concentration in the blood has been shown in many human intestinal diseases. FABP2 is a water soluble cytosolic protein with a small molecular weight of 14-15 kDa, and it is initially located in the mature enterocytes of the small intestine (PMID: 26547205). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse, rat, pig, chicken Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15793 Product name: Recombinant human FABP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-132 aa of BC069617 Sequence: MAFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVKESSAFRNIEVVFELGVTFNYNLADGTELRGTWSLEGNKLIGKFKRTDNGNELNTVREIIGDELVQTYVYEGVEAKRIFKKD Predict reactive species Full Name: fatty acid binding protein 2, intestinal Calculated Molecular Weight: 132 aa, 15 kDa Observed Molecular Weight: 15 kDa GenBank Accession Number: BC069617 Gene Symbol: FABP2 Gene ID (NCBI): 2169 RRID: AB_10734425 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P12104 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924