Proteintech, 21255-1-AP, IL-36 Gamma/IL-1F9 Polyclonal antibody

Size: 20ul / 150ul The IL-36 Gamma/IL-1F9 (21255-1-AP) by Proteintech is a Polyclonal antibody targeting IL-36 Gamma/IL-1F9 in IHC, ELISA applications with reactivity to human samples 21255-1-AP targets IL-36 Gamma/IL-1F9 in IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human oesophagus tissue, human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:20-1:200 Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15804 Product name: Recombinant human IL-1F9/IL-36 gamma protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-95 aa of BC098337 Sequence: MRGTPGDADGGGRAVYQSMCKPITGTINDLNQQVWTLQGQNLVAVPRSDSVTPVTVAVITCKYPEALEQGRGDPIYLGIQNPEMCLYCEKVGEQP Predict reactive species Full Name: interleukin 1 family, member 9 Calculated Molecular Weight: 169 aa, 19 kDa GenBank Accession Number: BC098337 Gene Symbol: IL-36 gamma/IL-1F9 Gene ID (NCBI): 56300 RRID: AB_2878832 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NZH8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.