Iright
BRAND / VENDOR: Proteintech

Proteintech, 21269-1-AP, RB1CC1 Polyclonal antibody

CATALOG NUMBER: 21269-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The RB1CC1 (21269-1-AP) by Proteintech is a Polyclonal antibody targeting RB1CC1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 21269-1-AP targets RB1CC1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, MCF-7 cells, HEK-293 cells Positive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information RB1CC1, also named as RBICC, is implicated in the regulation of RB1 expression and functions as a DNA-binding transcription factor. It is a potent regulator of the RB1 pathway and a mediator that plays a crucial role in muscular differentiation. Its expression is, thus, a prerequisite for myogenic differentiation. Involved in autophagy. RB1CC1 is required for autophagosome formation. It is probably involved in the tumorigenesis of breast cancer. RB1CC1 is frequently mutated in breast cancer and shows characteristics of a classical tumor suppressor gene. This antibody is a rabbit polyclonal antibody raised against residues near the N terminus of human RB1CC1. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15739 Product name: Recombinant human RB1CC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-350 aa of BC017556 Sequence: MKLYVFLVNTGTTLTFDTELTVQTVADLKHAIQSKYKIAIQHQVLVVNGGECMAADRRVCTYSAGTDTNPIFLFNKEMILCDRPPAIPKTTFSTENDMEIKVEESLMMPAVFHTVASRTQLALEMYEVAKKLCSFCEGLVHDEHLQHQGWAAIMANLEDCSNSYQKLLFKFESIYSNYLQSIEDIKLKLTHLGTAVSVMAKIPLLECLTRHSYRECLGRLDSLPEHEDSEKAETKRSTELVLSPDMPRTTNESLLTSFPKSVEHVSPDTADAESGKEIRESCQSTVHQQDETTIDTKDGDLPFFNVSLLDWINVQDRPNDVESLVRKCFDSMSRLDPRIIRPFIAECRQT Predict reactive species Full Name: RB1-inducible coiled-coil 1 Calculated Molecular Weight: 1594 aa, 183 kDa Observed Molecular Weight: 200 kDa GenBank Accession Number: BC017556 Gene Symbol: RB1CC1 Gene ID (NCBI): 9821 RRID: AB_10733100 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8TDY2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924