Proteintech, 21278-1-AP, AMIGO3 Polyclonal antibody

Size: 20ul / 150ul The AMIGO3 (21278-1-AP) by Proteintech is a Polyclonal antibody targeting AMIGO3 in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 21278-1-AP targets AMIGO3 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, human brain tissue, L02 cells, MCF-7 cells, mouse kidney tissue, mouse ovary tissue, fetal human brain tissue Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15790 Product name: Recombinant human AMIGO3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 221-504 aa of BC110418 Sequence: LPCDCRLYHLLQRWHQRGLSAVRDFAREYVCLAFKVPASRVRFFQHSRVFENCSSAPALGLERPEEHLYALVGRSLRLYCNTSVPAMRIAWVSPQQELLRAPGSRDGSIAVLADGSLAIGNVQEQHAGLFVCLATGPRLHHNQTHEYNVSVHFPRPEPEAFNTGFTTLLGCAVGLVLVLLYLFAPPCRCCRRACRCRRWPQTPSPLQELSAQSSVLSTTPPDAPSRKASVHKHVVFLEPGRRGLNGRVQLAVAEEFDLYNPGGLQLKAGSESASSIGSEGPMTT Predict reactive species Full Name: adhesion molecule with Ig-like domain 3 Calculated Molecular Weight: 504 aa, 55 kDa Observed Molecular Weight: 45-50 kDa GenBank Accession Number: BC110418 Gene Symbol: AMIGO3 Gene ID (NCBI): 386724 RRID: AB_10733101 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q86WK7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.