Proteintech, 21284-1-AP, NT5C1A Polyclonal antibody

Size: 20ul / 150ul The NT5C1A (21284-1-AP) by Proteintech is a Polyclonal antibody targeting NT5C1A in WB, ELISA applications with reactivity to human, mouse samples 21284-1-AP targets NT5C1A in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse heart tissue Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Background Information NT5C1A (5′-nucleotidase cytosolic 1A) is a 365 amino acid protein belonging to the 5′-nucleotidase type 3 family. AMP can be deaminated by AMP-deaminase (AMPD) to IMP, which is hydrolyzed to inosine by cytosolic 5'-nucleotidase II (NT5C2). AMP can also be hydrolyzed to adenosine by cytosolic 5'-nucleotidase 1A (NT5C1A). NT5C1A also assists in the regulation of adenosine levels in heart during ischemia and hypoxia. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15802 Product name: Recombinant human NT5C1A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-122 aa of BC103880 Sequence: MEPGQPREPQEPREPGPGAETAAAPVWEEAKIFYDNLAPKKKPKSPKPQNAVTIAVSSRALFRMDEEQQIYTEQGVEEYVRYQLEHENEPFSPGPAFPFVKALEAVNRRLRELYPDSEDVFD Predict reactive species Full Name: 5'-nucleotidase, cytosolic IA Calculated Molecular Weight: 368 aa, 41 kDa Observed Molecular Weight: 40-45 kDa GenBank Accession Number: BC103880 Gene Symbol: NT5C1A Gene ID (NCBI): 84618 RRID: AB_3085649 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BXI3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.