Iright
BRAND / VENDOR: Proteintech

Proteintech, 21310-1-AP, NHLRC1 Polyclonal antibody

CATALOG NUMBER: 21310-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The NHLRC1 (21310-1-AP) by Proteintech is a Polyclonal antibody targeting NHLRC1 in WB, IHC, ELISA applications with reactivity to human samples 21310-1-AP targets NHLRC1 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: L02 cells Positive IHC detected in: human heart tissue, human brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information NHLRC1(NHL repeat-containing protein 1) is also named as Malin,EPM2B. It is predicted to encode a 42.3-kDa (395amino acid) protein, malin, containing a detectable zinc-binding RING finger and six NHL-repeat domains(PMID:12958597).It can suppresses the cellular toxicity of misfolded proteins by promoting their degradation through the ubiquitin-proteasome system (UPS).Defects in NHLRC1 are a cause of progressive myoclonic epilepsy type 2 (EPM2).This antibody is specific to NHLRC1. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15940 Product name: Recombinant human NHLRC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 86-395 aa of BC103888 Sequence: VLHLIELLGSALRQSPAAHRAAPSAPGALTCHHTFGGWGTLVNPTGLALCPKTGRVVVVHDGRRRVKIFDSGGGCAHQFGEKGDAAQDIRYPVDVTITNDCHVVVTDAGDRSIKVFDFFGQIKLVIGGQFSLPWGVETTPQNGIVVTDAEAGSLHLLDVDFAEGVLRRTERLQAHLCNPRGVAVSWLTGAIAVLEHPLALGTGVCSTRVKVFSSSMQLVGQVDTFGLSLYFPSKITASAVTFDHQGNVIVADTSGPAILCLGKPEEFPVPKPMVTHGLSHPVALTFTKENSLLVLDTASHSIKVYKVDWG Predict reactive species Full Name: NHL repeat containing 1 Calculated Molecular Weight: 395 aa, 42 kDa Observed Molecular Weight: 45-47 kDa GenBank Accession Number: BC103888 Gene Symbol: NHLRC1 Gene ID (NCBI): 378884 RRID: AB_10733882 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6VVB1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924