Proteintech, 21325-1-AP, STARD13 Polyclonal antibody

Size: 20ul / 150ul The STARD13 (21325-1-AP) by Proteintech is a Polyclonal antibody targeting STARD13 in WB, IF/ICC, ELISA applications with reactivity to human, mouse samples 21325-1-AP targets STARD13 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: MCF-7 cells, HeLa cells Positive IF/ICC detected in: NIH/3T3 cells, A549 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15012 Product name: Recombinant human STARD13 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 113-393 aa of BC046563 Sequence: LDVNFQRKKGDDSDEEDLCISNKWTFQRTSRRWSRVDDLYTLLPRGDRNGSPGGTGMRNTTSSESVLTDLSEPEVCSIHSESSGGSDSRSQPGQCCTDNPVMLDAPLVSSSLPQPPRDVLNHPFHPKNEKPTRARAKSFLKRMETLRGKGAHGRHKGSGRTGGLVISGPMLQQEPESFKAMQCIQIPNGDLQNSPPPACRKGLPCSGKSSGESSPSEHSSSGVSTPCLKERKCHEANKRGGMYLEDLDVLAGTALPDAGDQSRMHEFHSQENLVVHIPKDH Predict reactive species Full Name: StAR-related lipid transfer (START) domain containing 13 Calculated Molecular Weight: 1113 aa, 125 kDa Observed Molecular Weight: 125 kDa GenBank Accession Number: BC046563 Gene Symbol: STARD13 Gene ID (NCBI): 90627 RRID: AB_2878840 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y3M8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.