Iright
BRAND / VENDOR: Proteintech

Proteintech, 21330-1-AP, C9orf7 / CACFD1 Polyclonal antibody

CATALOG NUMBER: 21330-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The C9orf7 / CACFD1 (21330-1-AP) by Proteintech is a Polyclonal antibody targeting C9orf7 / CACFD1 in WB, ELISA applications with reactivity to human, mouse, rat samples 21330-1-AP targets C9orf7 / CACFD1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse testis tissue, rat testis tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information Calcium Channel Flower Domain Containing 1 (CACFD1) also named as C9orf7 or human Flower protein (hFWE). In Drosophila, cell selection uses a cell selection mechanism based on 'fitness fingerprints', which allow it to delay ageing, prevent developmental malformations and replace old tissues during regeneration. At the molecular level, these fitness fingerprints consist of combinations of Flower membrane proteins. Proteins that indicate reduced fitness are called Flower-Lose, because they are expressed in cells marked to be eliminated. It has different isoforms, the calculated MW rang from 14-25 kDa. 21330-1-AP can detect a band around 25 kDa.(PMID:31341286) Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15336 Product name: Recombinant human C9orf7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-172 aa of BC030558 Sequence: MSSSGGAPGASASSAPPAQEEGMTWWYRWLCRLSGVLGAVSCAISGLFNCITIHPLNIAAGVWMIMNAFILLLCEAPFCCQFIEFANTVAEKVDRLRSWQKAVFYCGMAVVPIVISLTLTTLLGNAIAFATGVLYGLSALGKKGDAISYARIQQQRQQADEEKLAETLEGEL Predict reactive species Full Name: chromosome 9 open reading frame 7 Calculated Molecular Weight: 172 aa, 18 kDa Observed Molecular Weight: ~25 kDa GenBank Accession Number: BC030558 Gene Symbol: CACFD1 Gene ID (NCBI): 11094 RRID: AB_3085651 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UGQ2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924