Iright
BRAND / VENDOR: Proteintech

Proteintech, 21334-1-AP, CHD2 Polyclonal antibody

CATALOG NUMBER: 21334-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The CHD2 (21334-1-AP) by Proteintech is a Polyclonal antibody targeting CHD2 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, rat samples 21334-1-AP targets CHD2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, Jurkat cells, K-562 cells Positive IHC detected in: rat brain tissue, mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Chromodomain helicase DNA binding protein 2 (CHD2), a member of the sucrose nonfermenting (SNF-2) protein family of epigenetic regulators, which use the energy from ATP hydrolysis to change nucleosome positioning, composition and chromatin structure(PMID: 33435571). CHD2 protein plays a critical role in embryonic development, tumor suppression and survival(PMID: 24834135). In addition, CHD2 has been proposed to prevent breast cancer initiation, and CHD2 mutations are associated with chronic lymphocytic leukemia. Specification Tested Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15429 Product name: Recombinant human CHD2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-230 aa of BC020810 Sequence: MMRNKDKSQEEDSSLHSNASSHSASEEASGSDSGSQSESEQGSDPGSGHGSESNSSSESSESQSESESESAGSKSQPVLPEAKEKPASKKERIADVKKMWEEYPDVYGVRRSNRSRQEPSRFNIKEEASSGSESGSPKRRGQRQLKKQEKWKQEPSEDEQEQGTSAESEPEQKKVKARRPVPRRTVPKPRVKKQPKTQRGKRKKQDSSDEDDDDDEVPKRQTRRRAAKNV Predict reactive species Full Name: chromodomain helicase DNA binding protein 2 Calculated Molecular Weight: 1828 aa, 211 kDa Observed Molecular Weight: 230-250 kDa GenBank Accession Number: BC020810 Gene Symbol: CHD2 Gene ID (NCBI): 1106 RRID: AB_3085652 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O14647 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924