Proteintech, 21339-1-AP, RBM39 Polyclonal antibody

Size: 20ul / 150ul The RBM39 (21339-1-AP) by Proteintech is a Polyclonal antibody targeting RBM39 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 21339-1-AP targets RBM39 in WB, IHC, IF/ICC, RIP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293T cells, human skeletal muscle tissue Positive IHC detected in: human pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information RBM39, also named as HCC1 or RNPC2, is a 530 amino acid protein, which contains three RRM (RNA recognition motif) domains and belongs to the splicing factor SR family. RBM39 is widely expressed in various tissues and with highly expression in pancreas, skeletal muscle, lung and brain. RBM39 is a transcriptional coactivator for steroid nuclear receptors ESR1/ER-alpha and ESR2/ER-beta, and JUN/AP-1. RBM39 may be involved in pre-mRNA splicing process. Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15584 Product name: Recombinant human RBM39 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 328-530 aa of BC141835 Sequence: ERTDASSASSFLDSDELERTGIDLGTTGRLQLMARLAEGTGLQIPPAAQQALQMSGSLAFGAVAEFSFVIDLQTRLSQQTEASALAAAASVQPLATQCFQLSNMFNPQTEEEVGWDTEIKDDVIEECNKHGGVIHIYVDKNSAQGNVYVKCPSIAAAIAAVNALHGRWFAGKMITAAYVPLPTYHNLFPDSMTATQLLVPSRR Predict reactive species Full Name: RNA binding motif protein 39 Calculated Molecular Weight: 530 aa, 59 kDa Observed Molecular Weight: 60-70 kDa GenBank Accession Number: BC141835 Gene Symbol: RBM39 Gene ID (NCBI): 9584 RRID: AB_10733352 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q14498 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.