Proteintech, 21356-1-AP, PLEKHO2 Polyclonal antibody

Size: 20ul / 150ul The PLEKHO2 (21356-1-AP) by Proteintech is a Polyclonal antibody targeting PLEKHO2 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 21356-1-AP targets PLEKHO2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, mouse thymus tissue Positive IHC detected in: mouse spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Pleckstrin homology domain-containing proteins family O member 2 (PLEKHO2)'s function remains largely unknown. Genetic polymorphisms of PLEKHO2 contribute to diabetic retinopathy (DR) development. Functional prediction analysis strengthened the likelihood of participation of PLEKHO2 in the development of DR (Eric C. Han et al., 2012). Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15786 Product name: Recombinant human PLEKHO2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 91-440 aa of BC008744 Sequence: TRDRVRGGQRRRPPTRVHLKEVASAASDGLLRLDLDVPDSGPPVFAPSNHVSEAQPRETPRPLMPPTKPFLAPETTSPGDRVETPVGERAPTPVSASSEVSPESQEDSETPAEEDSGSEQPPNSVLPDKLKVSWENPSPQEAPAAESAEPSQAPCSETSEAAPREGGKPPTPPPKILSEKLKASMGEMQASGPPAPGTVQVSVNGMDDSPEPAKPSQAEGTPGTPPKDATTSTALPPWDLPPQFHPRCSSLGDLLGEGPRHPLQPRERLYRAQLEVKVASEQTEKLLNKVLGSEPAPVSAETLLSQAVEQLRQATQVLQEMRDLGELSQEAPGLREKRKELVTLYRRSAP Predict reactive species Full Name: pleckstrin homology domain containing, family O member 2 Calculated Molecular Weight: 490 aa, 53 kDa Observed Molecular Weight: 53 kDa GenBank Accession Number: BC008744 Gene Symbol: PLEKHO2 Gene ID (NCBI): 80301 RRID: AB_2878846 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8TD55 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.