Proteintech, 21361-1-AP, LST1 Polyclonal antibody

Size: 20ul / 150ul The LST1 (21361-1-AP) by Proteintech is a Polyclonal antibody targeting LST1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 21361-1-AP targets LST1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: THP-1 cells, mouse brain tissue, rat brain tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information LST1 (Leukocyte Specific Transcript 1), also known as B144, is a small adaptor protein expressed in leukocytes of myeloid lineage. LST1 splice variants (LST1/A-LST1/N) have been detected in various cell types, and thought to affect mainly LST1 gene expression and splicing, are associated with inflammatory conditions(PMID: 10706707, PMID: 33986741). The molecular weight of LSTI protein may vary between different lysates. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15817 Product name: Recombinant human LST1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 7-66 aa of BC103856 Sequence: VKRLERSWAQGSSEQELHYASLQRLPVPSSEGPDLRGRDKRGTKEDPRADYACIAENKPT Predict reactive species Full Name: leukocyte specific transcript 1 Calculated Molecular Weight: 97 aa, 11 kDa Observed Molecular Weight: 10-15 kDa GenBank Accession Number: BC103856 Gene Symbol: LST1 Gene ID (NCBI): 7940 RRID: AB_2918071 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O00453 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.