Proteintech, 21368-1-AP, ASCL2 Polyclonal antibody

Size: 20ul / 150ul The ASCL2 (21368-1-AP) by Proteintech is a Polyclonal antibody targeting ASCL2 in WB, IHC, ELISA applications with reactivity to human samples 21368-1-AP targets ASCL2 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: MKN-45 cells, Caco-2 cells Positive IHC detected in: human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Achaete-scute complex homolog 2 (Drosophila), also known as ASCL2, is an imprinted human gene. This gene is involved in the determination of the neuronal precursors in the peripheral nervous system and the central nervous system, particularly important during implantation of the developing embryo, specifically in placental development and neuronal precursor determination. ASCL2 has been reported involved in tumor progression, being upregulated in colorectal tumors, and involvement in metastasis could be attributed to ASCL2-promoted cellular self-renewal as opposed to cellular differentiation (PMID: 30096149 16568095). Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15839 Product name: Recombinant human ASCL2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 102-193 aa of BC057801 Sequence: LQRLLAEHDAVRNALAGGLRPQAVRPSAPRGPPGTTPVAASPSRASSSPGRGGSSEPGSPRSAYSSDDSGCEGALSPAERELLDFSSWLGGY Predict reactive species Full Name: achaete-scute complex homolog 2 (Drosophila) Calculated Molecular Weight: 193 aa, 20 kDa Observed Molecular Weight: 20 kDa GenBank Accession Number: BC057801 Gene Symbol: ASCL2 Gene ID (NCBI): 430 RRID: AB_2935452 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q99929 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.