Proteintech, 21375-1-AP, ERMAP Polyclonal antibody

Size: 20ul / 150ul The ERMAP (21375-1-AP) by Proteintech is a Polyclonal antibody targeting ERMAP in IF/ICC, IP, ELISA applications with reactivity to human samples 21375-1-AP targets ERMAP in WB, IF/ICC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive IP detected in: MCF-7 cells Positive IF/ICC detected in: MCF-7 cells Recommended dilution Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Specification Tested Reactivity: human Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15899 Product name: Recombinant human ERMAP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 176-475 aa of BC099703 Sequence: IWKQRRAKEKLLYEHVTEVDNLLSDHAKEKGKLHKAVKKLRSELKLKRAAANSGWRRARLHFVAVTLDPDTAHPKLILSEDQRCVRLGDRRQPVPDNPQRFDFVVSILGSEYFTTGCHYWEVYVGDKTKWILGVCSESVSRKGKVTASPANGHWLLRQSRGNEYEALTSPQTSFRLKEPPRCVGIFLDYEAGVISFYNVTNKSHIFTFTHNFSGPLRPFFEPCLHDGGKNTAPLVICSELHKSEESIVPRPEGKGHANGDVSLKVNSSLLPPKAPELKDIILSLPPDLGPALQELKAPSF Predict reactive species Full Name: erythroblast membrane-associated protein (Scianna blood group) Calculated Molecular Weight: 475 aa, 53 kDa Observed Molecular Weight: 53 kDa GenBank Accession Number: BC099703 Gene Symbol: ERMAP Gene ID (NCBI): 114625 RRID: AB_2878849 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96PL5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.