Proteintech, 21382-1-AP, EPHB3 Polyclonal antibody

Size: 20ul / 150ul The EPHB3 (21382-1-AP) by Proteintech is a Polyclonal antibody targeting EPHB3 in IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 21382-1-AP targets EPHB3 in IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: Jurkat cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information EPHB3 is a member of the Eph receptor tyrosine kinase family. The Eph receptors comprise a large family of closely related transmembrane tyrosine kinases that actively signal when bound to their ephrin ligands. The Eph receptors are characterized by an extracellular region with a unique cysteine-rich motif extending over its amino-terminal half, followed by two fibronectin type III motifs (PMID: 9530499). They are divided into two sub-groups (EphA and EphB) based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands (PMID: 11114742). The EPHB3 protein has multiple functions in the nervous system, including regulating neural networks, participating in epileptic activity, and playing a role in repair after spinal cord injury. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16016 Product name: Recombinant human EPHB3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 261-390 aa of BC052968 Sequence: EWMVPVGACTCATGHEPAAKESQCRPCPPGSYKAKQGEGPCLPCPPNSRTTSPAASICTCHNNFYRADSDSADSACTTVPSPPRGVISNVNETSLILEWSEPRDLGGRDDLLYNVICKKCHGAGGASACS Predict reactive species Full Name: EPH receptor B3 Calculated Molecular Weight: 998 aa, 110 kDa GenBank Accession Number: BC052968 Gene Symbol: EPHB3 Gene ID (NCBI): 2049 RRID: AB_3669366 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P54753 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.