Proteintech, 21383-1-AP, Pan-PAX Polyclonal antibody

Size: 20ul / 150ul The Pan-PAX (21383-1-AP) by Proteintech is a Polyclonal antibody targeting Pan-PAX in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 21383-1-AP targets Pan-PAX in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: SKOV-3 cells, A2780 cells Positive IP detected in: SKOV-3 cells Positive IHC detected in: human ovary cancer tissue, human kidney tissue, human renal cell carcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: SKOV-3 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:600-1:2400 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information PAX genes encode a family of developmentally regulated transcription factors that have been implicated in a number of human and murine congenital disorders, as well as in tumorigenesis. These genes are defined by the presence of an evolutionarily conserved DNA binding domain, termed the paired domain. Many paired domain-containing proteins recognize a common sequence motif. The immunogen of this atnibody is the Paired box domain of PAX family. This antibody is a Pan-PAX antibody. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16018 Product name: Recombinant human pan-PAX protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 10-140 aa of BC001060 Sequence: HGGLNQLGGAFVNGRPLPEVVRQRIVDLAHQGVRPCDISRQLRVSHGCVSKILGRYYETGSIRPGVIGGSKPKVATPKVVEKIGDYKRQNPTMFAWEIRDRLLAEGVCDNDTVPSVSSINRIIRTKVQQPF Predict reactive species Full Name: paired box 8 Calculated Molecular Weight: 450 aa, 48 kDa Observed Molecular Weight: 36-48 kDa GenBank Accession Number: BC001060 Gene Symbol: PAX8 Gene ID (NCBI): 7849 RRID: AB_10733094 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q06710 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.