Proteintech, 21386-1-AP, PAX3 Polyclonal antibody

Size: 20ul / 150ul The PAX3 (21386-1-AP) by Proteintech is a Polyclonal antibody targeting PAX3 in WB, IP, ELISA applications with reactivity to human, mouse, rat samples 21386-1-AP targets PAX3 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse skin tissue, HEK-293 cells Positive IP detected in: mouse skin tissue Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information PAX3, a transcription factor and multifunctional regulatory protein, is normally expressed during embryonic development. In the nervous system, PAX3 is involved in neural tube closure, neural crest development, and peripheral neuron differentiation. In the present study, PAX3 was reported as a novel regulator of GFAP transcription, and the overexpression and suppression of PAX3 could inhibit and promote NSC differentiation, respectively. In muscle development, PAX3 ensures the survival of myogenic progenitor cells with Pax3-expressing progenitors giving rise to both skeletal and smooth muscle cells. PAX3 also has a well-established role in the development of melanocytes during embryogenesis, and has recently been characterized as a molecular switch in the mature melanocyte. Mutations in PAX3 can cause Waardenburg syndrome. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, hamster Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16021 Product name: Recombinant human PAX3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 341-426 aa of BC101301 Sequence: QSTIPSNPDSSSAYCLPSTRHGFSSYTDSFVPPSGPSNPMNPTIGNGLSPQVMGLLTNHGGVPHQPQTDYALSPLTGGLEPTTTVS Predict reactive species Full Name: paired box 3 Calculated Molecular Weight: 484 aa, 53 kDa Observed Molecular Weight: 56-60 kDa GenBank Accession Number: BC101301 Gene Symbol: PAX3 Gene ID (NCBI): 5077 RRID: AB_10732817 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P23760 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.