Proteintech, 21405-1-AP, APRT Polyclonal antibody

Size: 20ul / 150ul The APRT (21405-1-AP) by Proteintech is a Polyclonal antibody targeting APRT in WB, IF/ICC, ELISA applications with reactivity to human samples 21405-1-AP targets APRT in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, A431 cells Positive IF/ICC detected in: A549 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16119 Product name: Recombinant human APRT protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-180 aa of BC106894 Sequence: MADSELQLVEQRIRSFPDFPTPGVVFRDISPVLKDPASFRAAIGLLARHLKATHGGRIDYIAGLDSRGFLFGPSLAQELGLGCVLIRKRGKLPGPTLWASYSLEYGKAELEIQKDALEPGQRVVVVDDLLATGGTMNAACELLGRLQAEVLECVSLVELTSLKGREKLAPVPFFSLLQYE Predict reactive species Full Name: adenine phosphoribosyltransferase Calculated Molecular Weight: 180 aa, 20 kDa Observed Molecular Weight: 20 kDa GenBank Accession Number: BC106894 Gene Symbol: APRT Gene ID (NCBI): 353 RRID: AB_10888630 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P07741 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.