Proteintech, 21425-1-AP, CNFN Polyclonal antibody

Size: 20ul / 150ul The CNFN (21425-1-AP) by Proteintech is a Polyclonal antibody targeting CNFN in IP, ELISA applications with reactivity to human, mouse samples 21425-1-AP targets CNFN in IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IP detected in: HK-2 cells, mouse skin tissue Recommended dilution Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information CNFN (cornifelin, also termed PLAC8L2) is highly expressed in the esophagus and skin, and is located on chromosome 19q13.2 (PMID: 30816522). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16012 Product name: Recombinant human CNFN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-112 aa of BC101197 Sequence: MSYPVTSQPQCATTSCYQTQLSDWHTGLTDCCNDMPVCLCGTFAPLCLACRISDDFGECCCAPYLPGGLHSIRTGMRERYHIQGSVGHDWAALTFCLPCALCQMARELKIRE Predict reactive species Full Name: cornifelin Calculated Molecular Weight: 112 aa, 12 kDa Observed Molecular Weight: 12 kDa GenBank Accession Number: BC101197 Gene Symbol: CNFN Gene ID (NCBI): 84518 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BYD5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.