Proteintech, 21430-1-AP, SLC24A6 Polyclonal antibody

Size: 20ul / 150ul The SLC24A6 (21430-1-AP) by Proteintech is a Polyclonal antibody targeting SLC24A6 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 21430-1-AP targets SLC24A6 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Positive IHC detected in: mouse brain tissue, mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information SLC24A6, also named as NCLX, is a kind of mitochondrial sodium/calcium antiporter that mediates sodium-dependent calcium efflux from mitochondrion by mediating the exchange of 3 sodium ions per 1 calcium ion. It has been reported that SLC24A6 plays a key role in attenuating potential ROS production and injury upon cardiac reperfusion. SLC24A6 is associated with mitochondrial calcium homeostasis by mediating mitochondrial calcium extrusion. (PMID: 32728214, 20018762, 28219928) Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16034 Product name: Recombinant human SLC24A6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 240-333 aa of BC098360 Sequence: YVVTVILCTWIYQRQRRGSLFCPMPVTPEILSDSEEDRVSSNTNSYDYGDEYRPLFFYQETTAQILVRALNPLDYMKWRRKSAYWKALKVFKLP Predict reactive species Full Name: solute carrier family 24 (sodium/potassium/calcium exchanger), member 6 Calculated Molecular Weight: 584 aa, 64 kDa Observed Molecular Weight: 64 kDa GenBank Accession Number: BC098360 Gene Symbol: SLC24A6 Gene ID (NCBI): 80024 RRID: AB_10858637 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6J4K2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.